Rabbit Polyclonal Anti-ONECUT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the middle region of human ONECUT1. Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA |
HNF6 (ONECUT1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 363-393 amino acids from the C-terminal region of Human ONECUT1 |
Rabbit Polyclonal Anti-ONECUT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the N terminal of human ONECUT1. Synthetic peptide located within the following region: NAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPR |
Germany
Japan
United Kingdom
China
