Antibodies

View as table Download

AMPD2 (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 194~224 amino acids from the Center region of human AMPD2

Rabbit polyclonal anti-AMPD2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AMPD2.

Rabbit Polyclonal Anti-AMPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMPD2 antibody is: synthetic peptide directed towards the N-terminal region of Human AMPD2. Synthetic peptide located within the following region: VVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSA

AMPD2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated