Antibodies

Jump to Filters
View as table Download
CBR1 Rabbit Polyclonal Antibody
TA311915

USD 345.00

In Stock

Rabbit polyclonal anti-CBR1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CBR1.
CBR1 Rabbit Polyclonal Antibody
TA332691

USD 275.00

3 Weeks

Rabbit anti-CBR1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CBR1
CBR1 Rabbit Polyclonal Antibody
TA338913

USD 375.00

5 Days

Rabbit Polyclonal Anti-CBR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the middle region of human CBR1. Synthetic peptide located within the following region: AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
CBR1 Rabbit Polyclonal Antibody
TA338914

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the C terminal of human CBR1. Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
CBR1 Rabbit Polyclonal Antibody
TA349648

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CBR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBR1