Antibodies

Jump to Filters
View as table Download
NORE1 (RASSF5) Rabbit Polyclonal Antibody
TA309829

USD 350.00

5 Days

Rabbit Polyclonal NORE1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Residues 313-329 [DNPQKFALFKRIHKDGQ] of the NORE1 protein. This sequence is located in the RA domain of NORE1.
NORE1 (RASSF5) Rabbit Polyclonal Antibody
TA342689

USD 375.00

5 Days

Rabbit Polyclonal Anti-RASSF5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rassf5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rassf5. Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK