Antibodies

View as table Download

Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062)

Rabbit Polyclonal Anti-PSMB8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PSMB8 antibody is: synthetic peptide directed towards the N-terminal region of Human PSMB8. Synthetic peptide located within the following region: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFF

Rabbit Polyclonal Anti-PSMB8 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PSMB8