Antibodies

Jump to Filters
View as table Download
SNAP23 Rabbit Polyclonal Antibody
TA346718

USD 475.00

5 Days

Rabbit Polyclonal Anti-SNAP23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNAP23 antibody: synthetic peptide directed towards the N terminal of human SNAP23. Synthetic peptide located within the following region: GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC
SNAP23 (1-132) Rabbit Polyclonal Antibody
AP23613PU-N

USD 440.00

2 Weeks

SNAP23 (1-132) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 132 of Human SNAP23
SNAP23 Rabbit Polyclonal Antibody
TA350431

USD 345.00

In Stock

Rabbit Polyclonal Anti-SNAP23 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SNAP23