Antibodies

Jump to Filters
View as table Download
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA327381

USD 275.00

In Stock

YWHAQ Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human YWHAQ
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA330345

USD 375.00

5 Days

Rabbit Polyclonal Anti-YWHAQ Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-YWHAQ antibody: synthetic peptide directed towards the N terminal of human YWHAQ. Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA312789

USD 345.00

4 Weeks

Rabbit polyclonal anti-14-3-3 theta antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 14-3-3 ?.
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA322463

USD 345.00

In Stock

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA322464

USD 345.00

In Stock

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA385581

USD 380.00

4 Weeks

14-3-3 theta Rabbit polyclonal Antibody

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human 14-3-3 Theta
14-3-3 theta (YWHAQ) Rabbit Monoclonal Antibody [Clone ID: R07-8G4]
TA385582

USD 380.00

4 Weeks

14-3-3 theta Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA392946

USD 285.00

4 Weeks

14-3-3 θ/τ (phospho-S232) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human 14-3-3 θ/τ around the phosphorylation site of Serine 232