Antibodies

Jump to Filters
View as table Download
Cyclin T1 (CCNT1) (Center) Rabbit Polyclonal Antibody
AP50822PU-N

USD 450.00

2 Weeks

Cyclin T1 (CCNT1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 256-285 amino acids from the Central region of human CCNT1
Cyclin T1 (CCNT1) Rabbit Polyclonal Antibody
TA319625

USD 430.00

5 Days

Rabbit Polyclonal CCNT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCNT1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CCNT1.
Cyclin T1 (CCNT1) Rabbit Polyclonal Antibody
TA350648

USD 345.00

In Stock

Rabbit Polyclonal Anti-CCNT1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCNT1
Cyclin T1 (CCNT1) Rabbit Polyclonal Antibody
TA319405

USD 530.00

5 Days

Rabbit polyclonal Cyclin T1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Cyclin T1 peptide corresponding to an internal region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).
Cyclin T1 (CCNT1) Rabbit Polyclonal Antibody
TA330358

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCNT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNT1 antibody: synthetic peptide directed towards the N terminal of human CCNT1. Synthetic peptide located within the following region: EGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQR
Cyclin T1 (CCNT1) Rabbit Polyclonal Antibody
TA363703

USD 360.00

5 Days

CCNT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CCNT1