Antibodies

View as table Download

Rabbit Polyclonal Anti-HSD3B1 Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ

Rabbit Polyclonal Anti-HSD3B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HSD3B1

HSD3B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human HSD3B1

HSD3B1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human HSD3B1 (NP_000853.1).
Modifications Unmodified