Rabbit Polyclonal IL-15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal IL-15 antibody was raised against a 13 amino acid peptide near the center of human IL-15. |
Rabbit Polyclonal IL-15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal IL-15 antibody was raised against a 13 amino acid peptide near the center of human IL-15. |
Anti-Human IL-15 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-15 |
Rabbit polyclonal anti-IL-15 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed mouse IL-15 |
Biotinylated Anti-Human IL-15 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-15 |
Biotinylated Anti-Murine IL-15 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine IL-15 |
Anti-Murine IL-15 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine IL-15 |
Rabbit polyclonal Anti-IL15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL15 antibody: synthetic peptide directed towards the N terminal of human IL15. Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV |
IL15 rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL15 |
IL15 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
IL15 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL15. |
Modifications | Unmodified |
IL-15 Rabbit polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from human protein at AA range: 111-160 |