Antibodies

Jump to Filters
View as table Download
OR10A4 (C-term) Rabbit Polyclonal Antibody
AP53002PU-N

USD 450.00

2 Weeks

OR10A4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 248-277 amino acids from the C-terminal region of Human Olfactory receptor 10A4
OR10A4 Rabbit Polyclonal Antibody
TA331499

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR10A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10A4 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10A4. Synthetic peptide located within the following region: TAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKAALKR