Antibodies

View as table Download

OR51S1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 212-241 amino acids from the C-terminal region of human Olfactory receptor 51S1

Rabbit polyclonal anti-OR51S1 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR51S1.

Rabbit Polyclonal Anti-OR51S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR51S1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR51S1. Synthetic peptide located within the following region: LDPLLIFFSYGLIGKVLQGVESREDRWKAGQTCAAHLSAVLLFYIPMILL