Rabbit Polyclonal Anti-ACBD3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACBD3 antibody: synthetic peptide directed towards the N terminal of human ACBD3. Synthetic peptide located within the following region: EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL |
Rabbit Polyclonal GOLPH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GOLPH1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human GOLPH1. |
ACBD3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ACBD3 (NP_073572.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China