Rabbit Polyclonal Anti-Phospho-ALOX5(Ser523) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-ALOX5(Ser523) Antibody: A synthesized peptide derived from human ALOX5 around the phosphorylation site of Sersine 523 |
| Modifications | Phospho-specific |
Rabbit polyclonal ALOX5 (Phospho-Ser523) antibody
| Applications | WB |
| Reactivities | Human: Ser524, Rat: Ser523 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ALOX5 around the phosphorylation site of serine523. |
| Modifications | Phospho-specific |
Rabbit Anti-5-Lipoxygenase (Ser523) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser523 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ALOX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human ALOX5. Synthetic peptide located within the following region: FGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYY |
Anti-ALOX5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 359 amino acids of Human Arachidonate 5-lipoxygenase Arachidonate 5-lipoxygenase |
ALOX5 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ALOX5 (NP_000689.1). |
| Modifications | Unmodified |
Phospho-ALOX5-S271 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S271 of human ALOX5 (NP_000689.1). |
| Modifications | Phospho S271 |
Germany
Japan
United Kingdom
China
