Antibodies

Jump to Filters
View as table Download
ACCN2 (ASIC1) Rabbit Polyclonal Antibody
TA338589

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACCN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACCN2 antibody: synthetic peptide directed towards the N terminal of human ACCN2. Synthetic peptide located within the following region: MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF
ACCN2 (ASIC1) Rabbit Polyclonal Antibody
TA350993

USD 345.00

In Stock

Rabbit Polyclonal Anti-ASIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ASIC1
ACCN2 (ASIC1) Rabbit Polyclonal Antibody
TA355728

USD 360.00

5 Days

ASIC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human ASIC1