Rabbit Polyclonal Anti-ATF5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF5 antibody: synthetic peptide directed towards the middle region of human ATF5. Synthetic peptide located within the following region: LPPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRK |
Rabbit polyclonal anti-ATF5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF5. |
Rabbit Polyclonal anti-ATF5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATF5 antibody is: synthetic peptide directed towards the N-terminal region of Human ATF5. Synthetic peptide located within the following region: MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDL |
ATF5 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF5. |
Germany
Japan
United Kingdom
China
