Antibodies

View as table Download

Rabbit Polyclonal Anti-ATP6V1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1A antibody: synthetic peptide directed towards the N terminal of human ATP6V1A. Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR

ATP6V1A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2).
Modifications Unmodified