Rabbit Polyclonal Anti-DNAAF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNAAF1antibody: synthetic peptide directed towards the N terminal of human LRRC50. Synthetic peptide located within the following region: LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF |
Rabbit Polyclonal Anti-DNAAF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNAAF1antibody: synthetic peptide directed towards the N terminal of human LRRC50. Synthetic peptide located within the following region: TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTL |
Germany
Japan
United Kingdom
China
