Antibodies

View as table Download

Rabbit Polyclonal Anti-GRAMD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRAMD3 antibody: synthetic peptide directed towards the middle region of human GRAMD3. Synthetic peptide located within the following region: LSRDSTYKLLKSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDE

GRAMD2B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GRAMD3