Rabbit Polyclonal Anti-H2AFV Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-H2AFV Antibody is: synthetic peptide directed towards the N-terminal region of Human H2AFV. Synthetic peptide located within the following region: MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGAT |
H2AFV Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-H2AFV antibody is: synthetic peptide directed towards the C-terminal region of Human H2AV |
Histone H2AFV Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human Histone H2AFV (NP_036544.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China