Germany
Japan
United Kingdom
China
Rabbit anti-KCNJ11 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KCNJ11 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-KCNJ11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KCNJ11 antibody is: synthetic peptide directed towards the middle region of HUMAN KCNJ11. Synthetic peptide located within the following region: SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLII |
Rabbit Polyclonal Anti-KCNJ11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNJ11 |
KCNJ11 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNJ11 |
Active filters
Target Symbol
- KCNJ11
Reactivities
- Human
Antibody Hosts
- Rabbit