Antibodies

Jump to Filters
View as table Download
LIPF Rabbit Polyclonal Antibody
TA346585

USD 475.00

5 Days

Rabbit Polyclonal Anti-LIPF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF. Synthetic peptide located within the following region: ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH
LIPF Rabbit Polyclonal Antibody
TA378068

USD 220.00

3 Weeks

LIPF Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 219-398 of human LIPF (NP_004181.1).
Modifications Unmodified