Antibodies

Jump to Filters
View as table Download
Neuraminidase (NEU1) Rabbit Polyclonal Antibody
TA335236

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-NEU1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
Neuraminidase (NEU1) Rabbit Polyclonal Antibody
TA379060

USD 220.00

3 Weeks

NEU1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 156-415 of human NEU1 (NP_000425.1).
Modifications Unmodified