Rabbit Polyclonal anti-RSAD2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RSAD2 antibody: synthetic peptide directed towards the C terminal of human RSAD2. Synthetic peptide located within the following region: YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY |
Rabbit Polyclonal anti-RSAD2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RSAD2 antibody: synthetic peptide directed towards the N terminal of human RSAD2. Synthetic peptide located within the following region: PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP |
RSAD2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 42-361 of human RSAD2 (NP_542388.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
