Antibodies

View as table Download

SLC44A2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC44A2

Rabbit Polyclonal Anti-SLC44A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC44A2 Antibody is: synthetic peptide directed towards the middle region of Human SLC44A2. Synthetic peptide located within the following region: IMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLGFQTDFRVY

SLC44A2 / CTL2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Human, Monkey, Orang-Utan, Gorilla, Gibbon
Conjugation Unconjugated
Immunogen SLC44A2 / CTL2 antibody was raised against synthetic 16 amino acid peptide from internal region of human SLC44A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Galago (94%); Bat (88%); Rat, Hamster, Elephant, Panda, Dog (81%).

Rabbit Polyclonal Anti-SLC44A2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC44A2

SLC44A2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC44A2 (NP_065161.3).
Modifications Unmodified