Antibodies

View as table Download

Rabbit Polyclonal Anti-SRY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRY antibody: synthetic peptide directed towards the middle region of human SRY. Synthetic peptide located within the following region: SEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL

Rabbit polyclonal anti-SRY antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SRY.