Antibodies

View as table Download

Rabbit Polyclonal Anti-TNNT3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNT3 antibody: synthetic peptide directed towards the C terminal of human TNNT3. Synthetic peptide located within the following region: QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK

Rabbit Polyclonal Anti-TNNT3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNT3 antibody: synthetic peptide directed towards the N terminal of human TNNT3. Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE