Rabbit Polyclonal Anti-TSC22D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the N terminal of human TSC22D2. Synthetic peptide located within the following region: CFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPE |
Rabbit Polyclonal Anti-TSC22D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the C terminal of human TSC22D2. Synthetic peptide located within the following region: ERNSLLERENALLKSLSSNDQLSQLPTQQANPGSTSQQQAVIAQPPQPTQ |
Rabbit polyclonal TSC22D2 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TSC22D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-62 amino acids from the N-terminal region of human TSC22D2. |
Rabbit Polyclonal Anti-TSC22D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the C terminal of human TSC22D2. Synthetic peptide located within the following region: KEQIKELVERNSLLERENALLKSLSSNDQLSQLPTQQANPGSTSQQQAVI |
Rabbit Polyclonal Anti-TSC22D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the C terminal of human TSC22D2. Synthetic peptide located within the following region: PVVKPPVADSLANPLQLTPMNSLATSVFSIAIPVDGDEDRNPSTAFYQAF |
Germany
Japan
United Kingdom
China
