Rabbit Polyclonal Anti-TXLNA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TXLNA antibody is: synthetic peptide directed towards the C-terminal region of Human TXLNA. Synthetic peptide located within the following region: LTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSAR |
Rabbit Polyclonal Anti-TXLNA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TXLNA antibody is: synthetic peptide directed towards the N-terminal region of Human TXLNA. Synthetic peptide located within the following region: APRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGA |
TXLNA rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TXLNA |
TXLNA Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TXLNA. |
Germany
Japan
United Kingdom
China
