Rabbit Polyclonal Anti-ZFAND3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFAND3 antibody: synthetic peptide directed towards the middle region of human ZFAND3. Synthetic peptide located within the following region: FCMLHRLPEQHDCTFDHMGRGREEAIMKMVKLDRKVGRSCQRIGEGCS |
Rabbit Polyclonal Anti-ZFAND3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZFAND3 Antibody: synthetic peptide directed towards the N terminal of human ZFAND3. Synthetic peptide located within the following region: DFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNNTSITTPTLSPSQQPLPT |
Rabbit Polyclonal Anti-ZFAND3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZFAND3 Antibody: synthetic peptide directed towards the middle region of human ZFAND3. Synthetic peptide located within the following region: SITTPTLSPSQQPLPTELNVTSPSKEECGPCTDTAHVSLITPTKRSCGTD |
ZFAND3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
ZFAND3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human ZFAND3 (NP_068762.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
