Rabbit Polyclonal AIG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AIG1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human AIG1. |
Rabbit Polyclonal AIG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AIG1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human AIG1. |
Rabbit Polyclonal Anti-Aig1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Aig1 antibody is: synthetic peptide directed towards the middle region of Mouse Aig1. Synthetic peptide located within the following region: AVFFGICVLTDLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVF |