Rabbit Polyclonal Anti-Arntl2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Arntl2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWA |
Rabbit Polyclonal Anti-Arntl2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Arntl2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV |
Germany
Japan
United Kingdom
China