Antibodies

Jump to Filters
View as table Download
CLCN6 Rabbit Polyclonal Antibody
TA338699

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLCN6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLCN6 antibody: synthetic peptide directed towards the C terminal of human CLCN6. Synthetic peptide located within the following region: PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS