Antibodies

Jump to Filters
View as table Download
Prdm4 Rabbit Polyclonal Antibody
TA329315

USD 375.00

5 Days

Rabbit Polyclonal anti-Prdm4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Prdm4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prdm4. Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS