Antibodies

View as table Download

Anti-UAP1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 290 amino acids of human UDP-N-acteylglucosamine pyrophosphorylase 1

Rabbit polyclonal Anti-Uap1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Uap1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LKDANDVPIQCEISPLISYAGEGLEGYVADKEFHAPLIIDENGVHELVKN