Antibodies

View as table Download

AKIRIN2 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen AKIRIN2 antibody was raised against akirin2 antibody was raised against a 15 amino acid peptide near the center of the human Akirin2.

Rabbit Polyclonal Akirin2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Akirin2 antibody was raised against a 15 amino acid peptide near the center of the human Akirin2.

Rabbit Polyclonal Akirin2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Akirin2 antibody was raised against a 15 amino acid peptide near the center of the human Akirin2.

Rabbit Polyclonal Anti-Akirin2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Akirin2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Akirin2. Synthetic peptide located within the following region: CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY