Rabbit Polyclonal Anti-DDX17 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX17 antibody: synthetic peptide directed towards the N terminal of human DDX17. Synthetic peptide located within the following region: TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY |
Rabbit Polyclonal Anti-DDX17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX17 antibody: synthetic peptide directed towards the N terminal of human DDX17. Synthetic peptide located within the following region: PKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKK |
DDX17 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DDX17. |
Germany
Japan
United Kingdom
China
