Antibodies

Jump to Filters
View as table Download
DGKA Rabbit Polyclonal Antibody
TA311874

USD 345.00

In Stock

Rabbit polyclonal anti-DGKA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKA.
DGKA Rabbit Polyclonal Antibody
TA337619

USD 375.00

5 Days

Rabbit Polyclonal Anti-DGKA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKA antibody: synthetic peptide directed towards the N terminal of human DGKA. Synthetic peptide located within the following region: EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL
DGKA Rabbit Polyclonal Antibody
TA375435

USD 220.00

3 Weeks

DGKA Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1).
Modifications Unmodified
DGKA Rabbit Polyclonal Antibody
TA375436

USD 220.00

3 Weeks

DGKA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1).
Modifications Unmodified