Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KIF2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF2C antibody: synthetic peptide directed towards the N terminal of human KIF2C. Synthetic peptide located within the following region: LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT |
KIF2C Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIF2C |
KIF2C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KIF2C |
KIF2C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KIF2C |
KIF2C rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KIF2C |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- KIF2C
Antibody Hosts
- Rabbit