Antibodies

Jump to Filters
View as table Download
Kallikrein 2 (KLK2) Rabbit Polyclonal Antibody
TA346241

USD 475.00

5 Days

Rabbit Polyclonal Anti-KLK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLK2 antibody: synthetic peptide directed towards the middle region of human KLK2. Synthetic peptide located within the following region: KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG
Kallikrein 2 (KLK2) Rabbit Polyclonal Antibody
TA322585

USD 345.00

4 Weeks

Anti-KLK2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 235-246 amino acids of Human kallikrein-related peptidase 2