Antibodies

Jump to Filters
View as table Download
LRRC6 (Center) Rabbit Polyclonal Antibody
AP52543PU-N

USD 450.00

2 Weeks

LRRC6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 186-215 amino acids from the Central region of human LRRC6
LRRC6 Rabbit Polyclonal Antibody
TA335648

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRRC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRRC6 Antibody: synthetic peptide directed towards the N terminal of human LRRC6. Synthetic peptide located within the following region: LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFL
LRRC6 Rabbit Polyclonal Antibody
TA335649

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRRC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRRC6 Antibody: synthetic peptide directed towards the middle region of human LRRC6. Synthetic peptide located within the following region: MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE