Germany
Japan
United Kingdom
China
Antibodies
View as table Download
KIAA0152 / MLEC Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Pufferfish (100%); Chicken, Xenopus (87%); Stickleback, Tick (80%). |
KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (94%). |
KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Pig, Rabbit |
| Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Platypus (100%); Mouse, Rat, Turkey, Chicken (94%); Xenopus, Pufferfish, Zebrafish (89%); Stickleback (83%). |
KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 14 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Chicken, Xenopus (100%). |
Rabbit Polyclonal Anti-KIAA0152 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIAA0152 antibody: synthetic peptide directed towards the C terminal of human KIAA0152. Synthetic peptide located within the following region: TVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNP |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- MLEC
Antibody Hosts
- Rabbit