Rabbit polyclonal anti-OR6C68 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR6C68. |
Rabbit polyclonal anti-OR6C68 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR6C68. |
Rabbit Polyclonal Anti-OR6C68 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR6C68 Antibody: synthetic peptide directed towards the N terminal of human OR6C68. Synthetic peptide located within the following region: MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA |