Germany
Japan
United Kingdom
China
PSMB10 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 213-242 amino acids from the C-terminal region of Human PSMB10 |
Antibodies
View as table Download
Rabbit polyclonal Anti-PSMB10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB10 antibody: synthetic peptide directed towards the middle region of human PSMB10. Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG |
PSMB10 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PSMB10 |
PSMB10 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-273 of human PSMB10 (NP_002792.1). |
| Modifications | Unmodified |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- PSMB10
Antibody Hosts
- Rabbit