Antibodies

View as table Download

Rabbit anti-RBP4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant Protein of human RBP4

Rabbit Polyclonal Anti-RBP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBP4 antibody: synthetic peptide directed towards the N terminal of human RBP4. Synthetic peptide located within the following region: MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP

RBP4 (169-183) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-183) KLH-conjugated
(VHNGYCDGRSERNLL)

RBP4 (169-183) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-183) KLH-conjugated
(VHNGYCDGRSERNLL)

RBP4 (169-182) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-182) KLH-conjugated (VHNGYCDGRSERNL)

RBP4 (169-182) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-182) KLH-conjugated (VHNGYCDGRSERNL)

RBP4 (169-181) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-181) KLH-conjugated (VHNGYCDGRSERN)

RBP4 (169-181) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-181) KLH-conjugated (VHNGYCDGRSERN)

RBP4 (169-179) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-179) KLH-conjugated (VHNGYCDGRSE)

RBP4 (169-179) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-179) KLH-conjugated (VHNGYCDGRSE)

RBP4 (169-176) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-176) KLH-conjugated (VHNGYCDG)

RBP4 (169-176) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Synthetic Human RBP4 (aa 169-176) KLH-conjugated (VHNGYCDG)

RBP4 (1-183) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Native Human RBP4 (aa 1-183) full length (signal peptid cleaved).

RBP4 (1-183) rabbit polyclonal antibody, Serum

Applications ELISA
Reactivities Human
Immunogen Native Human RBP4 (aa 1-183) full length (signal peptid cleaved).

Rabbit Polyclonal Anti-RBP4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBP4

RBP4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-201 of human RBP4 (NP_006735.2).
Modifications Unmodified