Rabbit Anti-Ribosomal S6 kinase 2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Rabbit Anti-Ribosomal S6 kinase 2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Rabbit polyclonal anti-S6K-a2 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human S6K-a2. |
Rabbit Polyclonal Anti-RPS6KA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RPS6KA2 Antibody: synthetic peptide directed towards the middle region of human RPS6KA2. Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR |
Rabbit Polyclonal Anti-RPS6KA2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RPS6KA2 |
Rps6ka2 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rps6ka2 |
RPS6KA2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RPS6KA2 |
RPS6KA2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 632-733 of human RPS6KA2 (NP_066958.2). |