Rabbit Polyclonal Anti-SCGN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCGN antibody: synthetic peptide directed towards the middle region of human SCGN. Synthetic peptide located within the following region: LQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDM |
Rabbit Polyclonal Anti-SCGN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCGN antibody: synthetic peptide directed towards the middle region of human SCGN. Synthetic peptide located within the following region: KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP |
SCGN rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SCGN |
SCGN rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SCGN |
Secretagogin (SCGN) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-276 of human Secretagogin (Secretagogin (SCGN)) (NP_008929.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China