Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC5A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC5A9

SGLT4 / SLC5A9 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Immunogen SLC5A9 / SGLT4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human SLC5A9. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Gibbon, Marmoset, Bovine (89%); Mouse (83%).

SGLT4 / SLC5A9 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen SLC5A9 / SGLT4 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human SLC5A9. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Bat, Bovine, Hamster, Elephant (93%); Turkey, Chicken (80%).

SGLT4 / SLC5A9 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human
Immunogen SLC5A9 / SGLT4 antibody was raised against synthetic 17 amino acid peptide from cytoplasmic domain of human SLC5A9. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset, Dog (94%); Bat, Horse, Pig, Opossum (88%); Elephant, Panda (82%).

SGLT4 / SLC5A9 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen SLC5A9 / SGLT4 antibody was raised against synthetic 17 amino acid peptide from internal region of human SLC5A9. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Elephant, Dog (94%); Galago, Panda, Bovine, Horse, Pig (88%); Mouse, Bat (82%).

Rabbit Polyclonal Anti-SLC5A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC5A9 Antibody: synthetic peptide directed towards the N terminal of human SLC5A9. Synthetic peptide located within the following region: MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA

SLC5A9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-320 of human SLC5A9 (NP_001011547.2).
Modifications Unmodified