Antibodies

View as table Download

Rabbit polyclonal anti-SLU7 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human SLU7.

Rabbit Polyclonal Anti-SLU7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLU7 antibody: synthetic peptide directed towards the N terminal of human SLU7. Synthetic peptide located within the following region: KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH

Slu7 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

SLU7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SLU7 (NP_006416.3).
Modifications Unmodified