Rabbit polyclonal anti-TLE2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TLE2. |
Rabbit polyclonal anti-TLE2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TLE2. |
TLE2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human TLE2 |
Rabbit Polyclonal Anti-TLE2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TLE2 antibody: synthetic peptide directed towards the N terminal of human TLE2. Synthetic peptide located within the following region: VEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSP |